Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIIYDGQVADNYMYQDSNQAAIVVSHSTPSLPYPFTMKPNNHSTETNTPPAIDVEKFVAKLESITSRRSKARCARSIRIALESAGADVENHPIAASDWGDTLKKIGYKEINP-A--FDEPQEGDIYIIHRTRNHIYGHIAGYTGSEWVSDFKQSSYDVYKDDNVTYTYYRLG 4F0W Chain:A ((60-132)) --------------------------------------------------------------------NKDNASGFVQSVAAELGVPM-PRGNAN-AMVDGL-EQSWTKLASGAEAAQKAAQGFLVIAGLK-GRTYGHVAVVISG---------------------------

General information: TITO was launched using: RESULT: Template: 4F0W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 243 -12683 -52.19 -181.19 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -52.19 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.312

(partial model without unconserved sides chains): PDB file : Tito_4F0W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4F0W-query.scw PDB file : Tito_Scwrl_4F0W.pdb: