Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------MKDSIVEPEGMENTFELYNKTTVDKLIPILVPTDLNGHDVLLRFN------GFLGEDYRYLKISDPQPLTE------------------------------ 5EUR Chain:A ((2-128)) SISYRKLDIALSADKETVLVFGQELSTKYFTEIVVTTMLNSTGSDMANSNRILNDIHAAGLDAGDYGKYSRWWAQSNAQERQEAERRRKEAKAHQERMAAIHAREEALIKRFG

General information: TITO was launched using: RESULT: Template: 5EUR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 215 6798 31.62 104.58 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 31.62 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.104

(partial model without unconserved sides chains): PDB file : Tito_5EUR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EUR-query.scw PDB file : Tito_Scwrl_5EUR.pdb: