Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAQEFSYEIVEEIAILSENNKGWRKELNLVSWNGRPPKFDLRDWAPDHEKMGKGLTLTNEEFEQLQKAIENM
2L3A Chain:B ((3-73))KMAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGKGITLSNEEFQTMVDAFKG-


General information:
TITO was launched using:
RESULT:

Template: 2L3A.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 218 4307 19.75 60.65
target 2D structure prediction score : 0.49
Monomeric hydrophicity matching model chain B : 0.86

3D Compatibility (PKB) : 19.75
2D Compatibility (Sec. Struct. Predict.) : 0.49
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.103

(partial model without unconserved sides chains):
PDB file : Tito_2L3A.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2L3A-query.scw
PDB file : Tito_Scwrl_2L3A.pdb: