Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNMKLLIENMTCGGCARGVTATIQDVDPNAKVDVDLASKIVTVESSESVDKITEALEEDGFPAKVQ 1FE0 Chain:B ((9-59)) --------DMTCGGCAEAVSRVLNKLG-GVKYDIDLPNKKVCIESEHSMDTLLATLKKTG------

General information: TITO was launched using: RESULT: Template: 1FE0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 139 -23707 -170.55 -464.84 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain B : 0.77 3D Compatibility (PKB) : -170.55 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.578

(partial model without unconserved sides chains): PDB file : Tito_1FE0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FE0-query.scw PDB file : Tito_Scwrl_1FE0.pdb: