Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGVVMACKGCEERREWIKQQYQLFKERLQLRKQRDTSTANPDSGAEYNTDSASSTKGSSDIGSTGTEQ 2K38 Chain:A ((1-35)) -------------------GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME--------------

General information: TITO was launched using: RESULT: Template: 2K38.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 14 481 34.36 13.74 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 34.36 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.648

(partial model without unconserved sides chains): PDB file : Tito_2K38.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K38-query.scw PDB file : Tito_Scwrl_2K38.pdb: