Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEQTIELTPTRPYLARAIYEWICDNQLTSYLLVDATQPHTDVPQQFVKDGQIVLNIVPHAVHQLLISNDAITFSARFGGVSKDIYVPIQAVLGIYARENGQGLFFDPEEYANVAPVEDKLDSEKQETSEPTKKKPTLRILD 5GMK Chain:T ((75-87)) ----------------KDLYDWLIKEKYA-----------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5GMK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 6 -2243 -373.75 -172.50 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain T : 0.55 3D Compatibility (PKB) : -373.75 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.730

(partial model without unconserved sides chains): PDB file : Tito_5GMK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GMK-query.scw PDB file : Tito_Scwrl_5GMK.pdb: