Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------PHFCEVSVSYENANKQ---KITTATKYVVPPGSVDIAVGSQMYAVTVDETCKRTDSISIPGRFKIDTQGKKLEGNPTENYIRSVVLQLNHRGLRMVSRPAP---
1NF3 Chain:C ((6-128))IVISMPQDFRPVSSIIDVDILPETHRRVRLCKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLA-VNDEVLEVNGIEVSGK-SLDQVTDMMIA-NSRNLIITVRPANQRN


General information:
TITO was launched using:
RESULT:

Template: 1NF3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 262 17659 67.40 185.88
target 2D structure prediction score : 0.77
Monomeric hydrophicity matching model chain C : 0.61

3D Compatibility (PKB) : 67.40
2D Compatibility (Sec. Struct. Predict.) : 0.77
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.280

(partial model without unconserved sides chains):
PDB file : Tito_1NF3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1NF3-query.scw
PDB file : Tito_Scwrl_1NF3.pdb: