Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KSYKAQKICHFTILKMYKN--TWTF---VRKDSAP-----ADQTTTIEGIKVFFSKDCIPQ-----HDYRGLY---IEYNGFHHDVSQS--------------- 1F68 Chain:A ((730-832)) -GDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG

General information: TITO was launched using: RESULT: Template: 1F68.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 164 -4518 -27.55 -64.54 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -27.55 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.276

(partial model without unconserved sides chains): PDB file : Tito_1F68.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F68-query.scw PDB file : Tito_Scwrl_1F68.pdb: