Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------------------------------DTNSQQFIQ-VRRLPGHVMGAVVRGSGCEFTLIKKNHK---PMVQKIVDT-SGDLDSNWKSIKIPFCGMTFNWAC---------NPIDHGQWKFHSITKDGKHQYIDVNALQV--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1VPR Chain:A ((868-1218))EKGFEAGDNKLGGALNAKHVEKYGDNFKNGMHKPEFHEDGLHKPMEVGGKKFESGFHYLLECHELGGKNASGGYGGPLCEDPYGSEVQAMTEKLLKEADS--------DRTLCFNNFQDPCPQLTKEQVAMCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKTNPL-HGRWITVS---GGQAAFIKEAIKSGMLGAAEANKIVADTDHHQTGGMYLRINQFGDVCTVDASVAKFARAKRTWKSGHYFYEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGRCFRIERRAFPVGPYTFMRQATEVGGKISFVFYVKVSNDPESDPIPLQSRDYTALAGRDNAPTNLGKPYPTLAKDLDYPKKRD


General information:
TITO was launched using:
RESULT:

Template: 1VPR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 23089 84.57 265.39
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : 84.57
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.57
QMean score : -0.063

(partial model without unconserved sides chains):
PDB file : Tito_1VPR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1VPR-query.scw
PDB file : Tito_Scwrl_1VPR.pdb: