Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTIFETVVTDVGIEAEVFRKEKIMILFGDEAPETLTDYCYKIELNQVRKEITCDMKLCFDKQMYVITAVGDVVQTNLNELGHITIKFDGSHEPELPGTMYVEDKEMPHLRKGTIIKIDQEDQNGGKLYGNHA 1IZ6 Chain:C ((10-30)) ------------------------------------------------SKLKPGRYIIIDDEPCRIVNI---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1IZ6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 31 -10332 -333.27 -491.98 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain C : 0.55 3D Compatibility (PKB) : -333.27 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.631

(partial model without unconserved sides chains): PDB file : Tito_1IZ6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IZ6-query.scw PDB file : Tito_Scwrl_1IZ6.pdb: