Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WECHVTVWEGNTPRGTEMLKEGGDDKTIAGYTCRAGAGCKAECDGMNPPFRVLGTPHSEWC 1H9I Chain:I ((8-30)) -------------------------------RCKQDSDCLAGCVCTNNKFC--GSP-----

General information: TITO was launched using: RESULT: Template: 1H9I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 50 -4029 -80.57 -175.15 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain I : 0.60 3D Compatibility (PKB) : -80.57 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.333

(partial model without unconserved sides chains): PDB file : Tito_1H9I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H9I-query.scw PDB file : Tito_Scwrl_1H9I.pdb: