Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MATAIENRARQLKNAKRGGYAPTIAKDVNKHKVQKIRRALDEARRYVSELNDETVIFDDQDARQKAEGAKAIIEMFEAALSGA 1W27 Chain:A ((34-90)) ------------------------AEAMTGSHLDEVKKMVAEYRKPVVKLGGETLTISQVAAISARDGSGVTVELSEAARAG-

General information: TITO was launched using: RESULT: Template: 1W27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 107 448 4.18 7.85 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : 4.18 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.327

(partial model without unconserved sides chains): PDB file : Tito_1W27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W27-query.scw PDB file : Tito_Scwrl_1W27.pdb: