Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKFQPIINQIKEKEHQQKIKDLFAKITETYPQLDTTVKW-NQPMFTDHGTFIIAFSFAKNHFSIAPEKAAIRALEKNIQEAGYVYTDNVIKVPWKSVINWELIEQLISFNIEDKKGHDKFWR 5KKZ Chain:C ((33-73)) -----PLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIF-----------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5KKZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 37 -7437 -200.99 -185.91 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain C : 0.61 3D Compatibility (PKB) : -200.99 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.607

(partial model without unconserved sides chains): PDB file : Tito_5KKZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5KKZ-query.scw PDB file : Tito_Scwrl_5KKZ.pdb: