Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCNISILKDGKYFTQKQEIAGWTVKFHDLDGNYVGKCKNAHTYACTYVTCEDLAPGYSPGKSKDVVASGNVGSLGHD 3DNL Chain:H ((237-292)) ----------------------------------GPCTNVSTVQCTH--------GIRPVVSTQLLLNG--------

General information: TITO was launched using: RESULT: Template: 3DNL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 13 20 1.50 0.72 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain H : 0.60 3D Compatibility (PKB) : 1.50 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.223

(partial model without unconserved sides chains): PDB file : Tito_3DNL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DNL-query.scw PDB file : Tito_Scwrl_3DNL.pdb: