Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFY 2ROR Chain:A ((28-102)) WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFY

General information: TITO was launched using: RESULT: Template: 2ROR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 269 -40560 -150.78 -540.80 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -150.78 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.533

(partial model without unconserved sides chains): PDB file : Tito_2ROR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ROR-query.scw PDB file : Tito_Scwrl_2ROR.pdb: