Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFY--ENKVYNVKIRFLERNQQFALGTGLRGDEKFDSVEDIIEHY 4NWG Chain:A ((112-219)) WFHGHLSG--AEKLLTEKGKHGSFLVRD--SQSHPGDFVLSVRTGD-SKVTHVMIRCQE------LKYDVGGGERFDSLTDLVEHY

General information: TITO was launched using: RESULT: Template: 4NWG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -16264 -62.31 -222.79 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.81 3D Compatibility (PKB) : -62.31 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.685

(partial model without unconserved sides chains): PDB file : Tito_4NWG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NWG-query.scw PDB file : Tito_Scwrl_4NWG.pdb: