Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY 1G83 Chain:A ((149-231)) WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY

General information: TITO was launched using: RESULT: Template: 1G83.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 298 -32286 -108.34 -388.99 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -108.34 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.601

(partial model without unconserved sides chains): PDB file : Tito_1G83.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1G83-query.scw PDB file : Tito_Scwrl_1G83.pdb: