Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence EMDPPAAEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY 5ITD Chain:B ((43-131)) --DISREEVNEKLRDTADGTFLVRDAST----DYTLTLRKGGNNKLIKIF--------SDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 5ITD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 163 -16200 -99.39 -270.00 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain B : 0.89 3D Compatibility (PKB) : -99.39 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.89 QMean score : 0.758

(partial model without unconserved sides chains): PDB file : Tito_5ITD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5ITD-query.scw PDB file : Tito_Scwrl_5ITD.pdb: