Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFD 2YU7 Chain:A ((8-83)) WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFD

General information: TITO was launched using: RESULT: Template: 2YU7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -25550 -97.89 -336.18 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -97.89 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.515

(partial model without unconserved sides chains): PDB file : Tito_2YU7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2YU7-query.scw PDB file : Tito_Scwrl_2YU7.pdb: