Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHY 2CI9 Chain:A ((7-81)) WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHY

General information: TITO was launched using: RESULT: Template: 2CI9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -28052 -99.48 -374.03 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.94 3D Compatibility (PKB) : -99.48 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.94 QMean score : 0.630

(partial model without unconserved sides chains): PDB file : Tito_2CI9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CI9-query.scw PDB file : Tito_Scwrl_2CI9.pdb: