Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYY 2MC1 Chain:A ((11-85)) WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFY

General information: TITO was launched using: RESULT: Template: 2MC1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 287 -38081 -132.69 -507.75 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.91 3D Compatibility (PKB) : -132.69 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.91 QMean score : 0.576

(partial model without unconserved sides chains): PDB file : Tito_2MC1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MC1-query.scw PDB file : Tito_Scwrl_2MC1.pdb: