Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQLGIKTRTWQGAATGAAGGAILGGVAYAATCWW 2AD7 Chain:A ((216-242)) -------------------------------------------QFGLGTKTWEGDAWKIGGGTNWGWYAY------

General information: TITO was launched using: RESULT: Template: 2AD7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 17 318 18.71 11.78 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : 18.71 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.264

(partial model without unconserved sides chains): PDB file : Tito_2AD7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AD7-query.scw PDB file : Tito_Scwrl_2AD7.pdb: