Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRSLTGVSNPTTDSARLVLAEANKAFADDSLTEQGLRDILQTVKDAIASLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK 4Y99 Chain:B ((17-63)) -----GKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEA-------------------------------------

General information: TITO was launched using: RESULT: Template: 4Y99.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 21 -955 -45.45 -20.31 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain B : 0.70 3D Compatibility (PKB) : -45.45 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.524

(partial model without unconserved sides chains): PDB file : Tito_4Y99.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4Y99-query.scw PDB file : Tito_Scwrl_4Y99.pdb: