Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELVLPNNYVVIDEEEMMYLDGGAIYIPRWAITGAITGAAYAALAAAGGGGLQLVLASYGLRSALVAGIVKGLGVL--GIH-IGNAFANTVIRSIASAGIGAGADWIFTNIIDGWDGRRDNQLRIG 4TLF Chain:A ((94-165)) -----------------------------WGLIGMLRGAEYSQPYAFDAGGRP---HPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGA----------------------

General information: TITO was launched using: RESULT: Template: 4TLF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 -11579 -48.65 -167.80 target 2D structure prediction score : 0.19 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -48.65 2D Compatibility (Sec. Struct. Predict.) : 0.19 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.041

(partial model without unconserved sides chains): PDB file : Tito_4TLF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4TLF-query.scw PDB file : Tito_Scwrl_4TLF.pdb: