Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVFLILIIAMIIYPKLRK 5H1Q Chain:A ((273-292)) ----YEKLFIFLWFWLVFVAVVST------------------------------------

General information: TITO was launched using: RESULT: Template: 5H1Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -971 -485.25 -48.53 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -485.25 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.196

(partial model without unconserved sides chains): PDB file : Tito_5H1Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5H1Q-query.scw PDB file : Tito_Scwrl_5H1Q.pdb: