Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAVSTSTVIRKLREFKFETDWTKLPKVMSWDEYSFKKSKMSFIAQDFESKSILAILDGRTHAVIRNHFQRYQREVRELVEVITMDMYSPYYRLAKQLFPKAKIVLDRFHIVQHLSRAMNRVRIQIMNQFDRKSLEYRALKRFWNPRFFVSRLGLNQSTGLIYYARIASSSVRNDSISPRFECT 2OHH Chain:A ((180-220)) -----------------------------------------------------------------------QRLDREIPEYILMDAARKFY--ANLITPLSKLVLKKFDEVKEL---------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2OHH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 29 -4342 -149.72 -105.90 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -149.72 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.251

(partial model without unconserved sides chains): PDB file : Tito_2OHH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OHH-query.scw PDB file : Tito_Scwrl_2OHH.pdb: