Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKVFKKYLHISPKKLKSLGRIVK 1BL0 Chain:A ((55-110)) -SLGQYIRSRKMTEIAQKLKES-NEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYR-------

General information: TITO was launched using: RESULT: Template: 1BL0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 168 -18286 -108.85 -326.54 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -108.85 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.831

(partial model without unconserved sides chains): PDB file : Tito_1BL0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BL0-query.scw PDB file : Tito_Scwrl_1BL0.pdb: