Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE 1IBY Chain:A ((37-102)) --------------------------------------------------PETLVVKKGDAVKVVVENK--SPISEGFSIDAFGVQEVIKAGETKTISFTADKAGAFTIWC---QLHPKNI--

General information: TITO was launched using: RESULT: Template: 1IBY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 224 -32706 -146.01 -495.55 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -146.01 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.413

(partial model without unconserved sides chains): PDB file : Tito_1IBY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IBY-query.scw PDB file : Tito_Scwrl_1IBY.pdb: