Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKMATDKNRIMISLDDKNLEKLENLVEDVRDRRGMRLTKSQVIELLLNTVDYFDDIMGAIYSKK 1KNV Chain:A ((45-87)) -----------------ENLDKLENYVKDVVKAKGLAIPTSGAFS---NTRGTWFEVMIAIQS--

General information: TITO was launched using: RESULT: Template: 1KNV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 54 -5973 -110.61 -138.91 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -110.61 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.617

(partial model without unconserved sides chains): PDB file : Tito_1KNV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KNV-query.scw PDB file : Tito_Scwrl_1KNV.pdb: