Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEIWKYRPFVSEFWNDFKNNHDKQFVDPISLYLTLKDDDDPRIEEES-EALENMILQYLGEDDAS 1H82 Chain:A ((332-373)) --------------WQEF----EKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVL------

General information: TITO was launched using: RESULT: Template: 1H82.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 54 -7736 -143.25 -188.67 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -143.25 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.661

(partial model without unconserved sides chains): PDB file : Tito_1H82.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H82-query.scw PDB file : Tito_Scwrl_1H82.pdb: