Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNFNSNEKFCGKSLKSLSADEMSLIYGASDGAEPRWTPTPIILKSAAASSKVCISAAVSGIGGLVSYNNDCLG 3WCV Chain:D ((3-31)) ---------FCSEADATIVIKQWNQIYNAGIGAKSRWT------------------------------------

General information: TITO was launched using: RESULT: Template: 3WCV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 20 -1562 -78.10 -53.86 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain D : 0.60 3D Compatibility (PKB) : -78.10 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.432

(partial model without unconserved sides chains): PDB file : Tito_3WCV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3WCV-query.scw PDB file : Tito_Scwrl_3WCV.pdb: