Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTTSSATTPIEINALGQPCPMPLLMLKRELKKL--SGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQISEREFHYLIETQ 3HZ7 Chain:A ((2-39)) ----------ITIDALGQVCPIPVIRAKKALAELGEAGGVVTVLVDND-----------------------------------

General information: TITO was launched using: RESULT: Template: 3HZ7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 89 -9939 -111.67 -276.07 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -111.67 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.666

(partial model without unconserved sides chains): PDB file : Tito_3HZ7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3HZ7-query.scw PDB file : Tito_Scwrl_3HZ7.pdb: