Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVRTTRLY 5MY1 Chain:U ((4-54)) ---IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVK-----------------

General information: TITO was launched using: RESULT: Template: 5MY1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain U - contact count / total energy / energy per contact / energy per residue : 40 2449 61.23 48.02 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain U : 0.86 3D Compatibility (PKB) : 61.23 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.462

(partial model without unconserved sides chains): PDB file : Tito_5MY1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5MY1-query.scw PDB file : Tito_Scwrl_5MY1.pdb: