Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHEITLHEVRQLIASLRTVYAAQFNKQFPTSGESAIPLSVVEQIALKTLVGVQQNQFNNALARLLTAGGRFMPSFAEFRTWCIGESWMSPEEAWSRACKFTTDRTVVITQITKYALDEVMYLIEAGQMRAAQDNFFGTYNVMVAKAQLKGRQQEFYTPPLQLEHKEPEHTPVSNDEVQKQLKSLMERLKINGRKPAPVQKLQAKEKEPELAKELGPDPFDNPHEYAEMCRREGMPIPRNILQLIEGANV 1NO1 Chain:B ((2-67)) ----IEKDVVQILKAVSEFYPGRFQP---D-DLK-----GTVKAWHRVLAEYELEEIMNNLTDYAK-VNKFPPTVSDLLK-------------------------------------------------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1NO1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 177 -30808 -174.06 -466.79 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -174.06 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.628

(partial model without unconserved sides chains): PDB file : Tito_1NO1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NO1-query.scw PDB file : Tito_Scwrl_1NO1.pdb: