Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQYSMRFWKNKYFLLIMLCLGVISPSVYAQSFDQNFQEWKAKQQMYDQKLNISKSSHSNSSKISQTKNFNDSTGQIHLNQANVNEFQQLKGVGEKKAQAIVEYRQKNGSFKNIDEIKNVKGIGPAIFEKNKSRLAL 3BZC Chain:A ((500-553)) ---------------------------------------------------------------------------VDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQ-------

General information: TITO was launched using: RESULT: Template: 3BZC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 167 -25315 -151.59 -468.80 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -151.59 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.758

(partial model without unconserved sides chains): PDB file : Tito_3BZC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BZC-query.scw PDB file : Tito_Scwrl_3BZC.pdb: