Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLQRG-IYQHYKGNLYQVFSVAKHSETEEELVVYQCLYGD--YSTWVRPLDMFTETVQMSDGSIVPRFKLIQST 3BE3 Chain:B ((6-78)) -QDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPMSTRLLRIWNETVDT-GAGPQPRFAYVGHV

General information: TITO was launched using: RESULT: Template: 3BE3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 221 -19286 -87.27 -275.51 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain B : 0.76 3D Compatibility (PKB) : -87.27 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.488

(partial model without unconserved sides chains): PDB file : Tito_3BE3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BE3-query.scw PDB file : Tito_Scwrl_3BE3.pdb: