Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLETLLQAILEQIDEPKKDLEKNLRALLNETVEKLDLVSKQEIERQKTALHLANQRLEALQKQVSLLEEALKNKK 5J9W Chain:H ((53-113)) --------IRQQGSIPKHPQEDGLDKEIKESLLKCQSLQREKCVLANTALFLIARHLNKLEKNIALLEE------

General information: TITO was launched using: RESULT: Template: 5J9W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 17 3181 187.12 52.15 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain H : 0.72 3D Compatibility (PKB) : 187.12 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.616

(partial model without unconserved sides chains): PDB file : Tito_5J9W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5J9W-query.scw PDB file : Tito_Scwrl_5J9W.pdb: