Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWYFAWILGILMACFAGVLSALYIEHHQNLDEE 2HAC Chain:A ((-3-30)) ---LCYLLDGILFIYGVILTALFLRVKFSRSAD

General information: TITO was launched using: RESULT: Template: 2HAC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 7 -2679 -382.64 -89.28 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -382.64 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.70 QMean score : -0.035

(partial model without unconserved sides chains): PDB file : Tito_2HAC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HAC-query.scw PDB file : Tito_Scwrl_2HAC.pdb: