Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPRSLKKGPFVDAHLFAKVEAAVASNSRKPIKTWSRRSMILPDFVGLTISVHNGRNHVPVIVTEHMVGHKLGEFAPTRTYRGHGVDKKSKR 4ADV Chain:S ((2-80)) --RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYR----------

General information: TITO was launched using: RESULT: Template: 4ADV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 293 -51116 -174.46 -647.04 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain S : 0.92 3D Compatibility (PKB) : -174.46 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.92 QMean score : 0.530

(partial model without unconserved sides chains): PDB file : Tito_4ADV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ADV-query.scw PDB file : Tito_Scwrl_4ADV.pdb: