Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEWFCKFLLFLEVIHVYGFVFLTNKKAGSTMDHLYIKYIHQFSVLVLGTLIIAGIVAFIIQGRDILTVHQEFFSYAFGIPLIAIRSDNKKWKKRYYILLLFLCFYLPPKIFTLLGIQCLSFSFISYIIVLIFLSFIVWMFYLVKK 5DJQ Chain:O ((9-29)) ---------------------------------------AGVVTVGLMVAFLAGFGYFIW-------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5DJQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain O - contact count / total energy / energy per contact / energy per residue : 2 -487 -243.25 -23.17 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain O : 0.39 3D Compatibility (PKB) : -243.25 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.39 QMean score : 0.787

(partial model without unconserved sides chains): PDB file : Tito_5DJQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DJQ-query.scw PDB file : Tito_Scwrl_5DJQ.pdb: