Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDLKTFTAQIELMHQEAL--RQSVSYEDKWLNTFHGGRESALDQVLKLLKGECRDG 5H66 Chain:C ((43-71)) --VVTFLAVLELMKNQLVLIEQEHNFSDIYI-------------------------

General information: TITO was launched using: RESULT: Template: 5H66.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 26 -4561 -175.40 -168.91 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain C : 0.65 3D Compatibility (PKB) : -175.40 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.446

(partial model without unconserved sides chains): PDB file : Tito_5H66.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5H66-query.scw PDB file : Tito_Scwrl_5H66.pdb: