Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGYDKHQARTSGWRVPENNLIFVSLLGGGLGGLISRKVFHHKTRKKKFTIGFAAGVLVDLILIYFFH 3KU3 Chain:B ((12-31)) --------------------------GGWQGMVDGWYGYHHSNDQG---------------------

General information: TITO was launched using: RESULT: Template: 3KU3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 10 -552 -55.20 -27.60 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain B : 0.46 3D Compatibility (PKB) : -55.20 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.448

(partial model without unconserved sides chains): PDB file : Tito_3KU3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KU3-query.scw PDB file : Tito_Scwrl_3KU3.pdb: