Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFDFFTKSFILSIIDNKNVLEEALTMNVKIFSKNNCMQCKMVKRFLTENQIAFEEVNIDEQPEAVDWLKAQGFQSVPVITSDAETVIGFRPDQLRKLAS 4K8M Chain:A ((1-73)) --------------------------TVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAG

General information: TITO was launched using: RESULT: Template: 4K8M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 289 -46892 -162.25 -642.35 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -162.25 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.798

(partial model without unconserved sides chains): PDB file : Tito_4K8M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K8M-query.scw PDB file : Tito_Scwrl_4K8M.pdb: