Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMILEYSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTLPPLMEETDEGSAANDRRYAMLDKRDIPGGENLKVTLERALPFWQDEIAPALLDNKTVLVAAHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
3FDZ Chain:B ((83-236))------DLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYL


General information:
TITO was launched using:
RESULT:

Template: 3FDZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 560 34842 62.22 226.24
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain B : 0.84

3D Compatibility (PKB) : 62.22
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.84
QMean score : -0.072

(partial model without unconserved sides chains):
PDB file : Tito_3FDZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3FDZ-query.scw
PDB file : Tito_Scwrl_3FDZ.pdb: