Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 1X0N Chain:A ((5-80)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 1X0N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 254 -34774 -136.91 -457.55 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -136.91 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.735

(partial model without unconserved sides chains): PDB file : Tito_1X0N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1X0N-query.scw PDB file : Tito_Scwrl_1X0N.pdb: