Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------MVAGLTNGELIAPMTYEEMVTSDFFEAWFQKFLLPTLTT-----PSVIIMDNARFHRMGKLELLCEEFGHKLLPLPPYSPEYNPIEKTWAYIKKNLKKVLPSCNTFYEALFSCSCFN------------------------------
5CR4 Chain:A ((7-230))ARKKPLLQNRHKKARLRFATAHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAGGTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEWPSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPNYCGKLVEGYPKRLTQVKQFKGNATKY


General information:
TITO was launched using:
RESULT:

Template: 5CR4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 227 13568 59.77 121.14
target 2D structure prediction score : 0.71
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 59.77
2D Compatibility (Sec. Struct. Predict.) : 0.71
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.411

(partial model without unconserved sides chains):
PDB file : Tito_5CR4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5CR4-query.scw
PDB file : Tito_Scwrl_5CR4.pdb: