Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFQGYSKDRREETCSYCGAIYIVDIPGLPGHEEREEYFCPECSHVNFARASN-SPRVSLVKARTDGKNDKSPSFQALIDSYKDE--- 2LQ6 Chain:A ((9-87)) --MNIPPARWKLTCYLCKQ------KGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGST

General information: TITO was launched using: RESULT: Template: 2LQ6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 232 -3981 -17.16 -53.07 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -17.16 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.218

(partial model without unconserved sides chains): PDB file : Tito_2LQ6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LQ6-query.scw PDB file : Tito_Scwrl_2LQ6.pdb: