Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLYDLLQTKHIYIVCGK-----TDLRKGIDGLASLIQQEYQLE----LYEDAVFLFCGNRQDRFKLLYWDGDGFLLCY--------------KRIENGK---LKWPRTKDEVRTLTNQPVKWLLEGLSIDQPRAIL---PGKKGVF--------------------------
4M02 Chain:A ((36-204))---AVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTT


General information:
TITO was launched using:
RESULT:

Template: 4M02.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 430 17005 39.55 149.17
target 2D structure prediction score : 0.38
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : 39.55
2D Compatibility (Sec. Struct. Predict.) : 0.38
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.262

(partial model without unconserved sides chains):
PDB file : Tito_4M02.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4M02-query.scw
PDB file : Tito_Scwrl_4M02.pdb: