Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSLKTELVIFDWDGTLYNSVGQIVASLQHAAEEHKLTLTDEAAKSIIGLGLPEVMQTLFPEV-P--DLHDSILKAYGDHYIAN-ST-NDAWFEGISELLHDLKAQGLKLAVATGKNRRGLDRVIAKTQSTHLF--DVTRAANE-TRSKPDPLMLQEILTVTGVSVEQAVMIGDSSYDLEMAQRLGMPRIGVGYGVHSVEVLQQFQPLTIAKDVSELHNFLREYAKLSTVDVA
3QU5 Chain:B ((21-241))-RKKLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHN-FPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTI---------


General information:
TITO was launched using:
RESULT:

Template: 3QU5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1204 6246 5.19 29.32
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain B : 0.71

3D Compatibility (PKB) : 5.19
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.548

(partial model without unconserved sides chains):
PDB file : Tito_3QU5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3QU5-query.scw
PDB file : Tito_Scwrl_3QU5.pdb: