Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNISEQQHQKNIQSWHEPALRTLSGLLAERKRNLARQKRDVKNAAVTRDEFMQALVDEHGKHGIYLIHAGQIISSLYRAKRIRYLGSTFIQKNEEGDE 3JCM Chain:W ((11-83)) QPVN-----------PKPFLKGLVN-----HRVGVKLKTEYRGTLVSTDNYFNLQLNEAEEF-VAGVSHGTLGEIFIRCNNVLYIRE-----------

General information: TITO was launched using: RESULT: Template: 3JCM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 250 -9516 -38.06 -135.94 target 2D structure prediction score : 0.19 Monomeric hydrophicity matching model chain W : 0.72 3D Compatibility (PKB) : -38.06 2D Compatibility (Sec. Struct. Predict.) : 0.19 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.146

(partial model without unconserved sides chains): PDB file : Tito_3JCM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JCM-query.scw PDB file : Tito_Scwrl_3JCM.pdb: